PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_6763g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family TALE
Protein Properties Length: 990aa    MW: 109782 Da    PI: 8.216
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_6763g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.62.5e-096937301954
                   HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
      Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                   Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  MA_6763g0010 693 FEHflHPYPTDADKHILAKQTGLTRSQVSNWFINARVR 730
                   554459******************************88 PP

2BELL1153.7e-37555625272
          BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                   r elq++kakL+s+l+eVd+rY+ y++q++ v+ssFe v  lg+a+pYt+lAlka+SrhFrcLkdai++q+
  MA_6763g0010 555 RFELQRRKAKLVSMLDEVDRRYRNYCDQMHLVVSSFESVSTLGAAAPYTALALKAMSRHFRCLKDAITGQL 625
                   779*****************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005748.3E-54480623IPR006563POX domain
PfamPF075264.5E-47486622IPR006563POX domain
PROSITE profilePS5007112.39671734IPR001356Homeobox domain
CDDcd000861.20E-12674735No hitNo description
SMARTSM003895.6E-10674738IPR001356Homeobox domain
SuperFamilySSF466893.51E-17675741IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-28677741IPR009057Homeodomain-like
PfamPF059203.9E-18691730IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009965Biological Processleaf morphogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 990 aa     Download sequence    Send to blast
MWGRLWGYCT VDIVRTSYRG NVAVGRLPRK RSDGQCYRWR EAKKRTMLTE DYFGNHDGLI  60
RWGKKREPVI GRRGGRVKRV LLKWLRVFGF RCSSSADGVA VELLEWTIKP VFIRLELTDF  120
FLGFLGVSRG IELLAFSSKN PFLDNSEAEA SSRSAVIGTS YQGLGNPGAN LGNWKSFNAP  180
QNRSNTGWAA PSIIVPNNIQ QHHGGLPSYS GQIIPNPIIV ARGGSMQVSS SGDIRKGDMD  240
VASQNPHHQT DGTHLYLMNP KYPNQYPEGT STAAANMTEI RPTNGLTPQG FEAQKNILEF  300
AHFPSQIPTI ISEASPSLRE PSHGTGSDLP GSENMQHSQL VLTQFNNSVN WATRYSGSQS  360
WNREQFIENK VDESFRSEYS SKGQDGSGQR LSLSLSSHQP SEIHLPDIAN QTNVLQFGGD  420
AKSKLGDLFN SAHGTDGLAY NISSYSRNGI PGKGMMDSIQ GGGRSAVLQY MKDGSTGACA  480
GYGISLKNSR YLKAAQEILY EFCNVGRGFE TKASPKQKLS MGVNVIPGSS STRSHEFGAK  540
TETGMMNQPF YSEDRFELQR RKAKLVSMLD EVDRRYRNYC DQMHLVVSSF ESVSTLGAAA  600
PYTALALKAM SRHFRCLKDA ITGQLQVTIK ALGEKGSVVP GTSRGETPRL GFLERSIRQQ  660
RAFHHLGLME QHPWRPQRGL PERSVSVLRA WLFEHFLHPY PTDADKHILA KQTGLTRSQV  720
SNWFINARVR LWKPMVEEMY MEEIKEEKVD EVGQNAEAER STGTNNDEKT MFNSGGPGSK  780
CTANSEEAAF KLDHSSSTTS QTAQAEISSG NVTLHLQSKD PEMAVARETS EPLSSMNTSH  840
EGDMKLDEAP GYNIFDQDKG FRSELYASKF QTADHTGMAV DFSSYNNTTA STTVTAYSHG  900
DLTPRHFASN GVSLTLGLRH SGGLSYNPLS EQKYDNNIYF SRVHDDADPN NQYSMLDSEV  960
SPGNGFMQEQ DIQYRNYIVN GSRLLHDFVG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_B2e-16680737158Homeobox protein Meis1
4xrs_A2e-16680737158Homeobox protein Meis1
5bng_A2e-16680738159Homeobox protein Meis2
5bng_B2e-16680738159Homeobox protein Meis2
4xrm_B3e-16680738563Homeobox protein Meis2
4xrm_A3e-16680738563Homeobox protein Meis2
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1033970.0BT103397.1 Picea glauca clone GQ02512_F23 mRNA sequence.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP13316172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23760.31e-86BEL1-like homeodomain 4